GenomeNet

>mjd:JDM601_3038 DNA ligase-like protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MKPNVSITHPDRVLFPASDTHEAITKGDLIDYYAELAPVMVPHLDGRPLTLTRFPGGIDE
EGFIQQNFAAALPDWMDRVEVARKSGEGTVVHPVVTREEALVWAANQDCITLHSWSSRRP
HLDTPDRLIFDLDPADDDFAVVRATARSVADVVQELGMTAYVQTTGSRGLHIVAPLRGDA
DFDTAREFASTIAGLVVDDDPLHRTREIRKAGRGGRVYVDVMRNAYGQTGVAPYAVRARA
GAPVALPLEWDELDIPGIRPDGWTLRDVPKRMCERGDPWADMYRQACALAPLRDRLAKLG
A

BLAST