GenomeNet

>mjd:JDM601_4022 hypothetical protein (A)
MPAGDSAEELDVDGTAVRFTSGDKVYFPRLGAGGTKRALADYYLTVANGPLLQALADRPT
HLQRFPDGIQGAEVYQKRLPRGHPDYLQSCRVTFPSGRTADALKVTRPADILWAVQMSTV
TFHPWPVRCGDTDHPDELRIDLDPQPGTGFAEARAVALEVLRPLLDELGLVGYVKTSGGR
GLHVFLRIKTDWDFIEVRRAGIALARELERRAPEAVTSSWWKEERGKRIFIDFNQNARDR
TMASAYSVRATPIATVSMPLTWDGLAEGADPDDYTIATVPDLIARRGDAWETIDGLEQSL
QPLLEMVAADEARGLGDLPYPPNYPKMPGEPPRVQPSKQVAEHWDDKGNRR

BLAST