GenomeNet

>mkm:Mkms_5557 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA ligase (ATP) (A)
MTRASLSPDRLVAPAPMLATLGPAPRGGQFAVEVKFDGQRGILTVDRRVQVTSRNGADIT
ETFPELSAVAAAVGGRRMVLDGEIVAVDEHGRPSFRRLQRRWPQQRRPGAQLVREVPTRF
LAFDVMNIEGEDITHWPYRERRELLDTLMVMESSPALTVPRHWTDVAPADMLAICADQHH
EGIVCKRLDSPYRSGRSRDWIKCPVRATTEAVIVGAFAGHRGEVGTLVLAAHDEAGQLVL
LGQVGTGFSGAERRRLATLLAGTEVSAPPVAVGASMSGVQWFKPRYVGEVAYREYHAGKG
LRHASWKGLRSEPASGVCLPRDAGAAPG

BLAST