GenomeNet

>mli:MULP_04790 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP dependent DNA ligase (EC:6.5.1.1) (A)
MYSAIRRPRASRPMWVSRSTSRPNLASPTATLRGLPPTYSAGSGPSTMSIRASPITSPRA
MATGYVGHMGSAQAWPPGQANGPQVTLTNADKVLYPATGTTKSDVFGYYTGIAEVMIPHI
AGRPATRKRWPNGVDQASFFEKQLASSAPDWLPRASVVHRSGTTTYPIIDSATGLAWIAQ
QAALEVHVPQWRFVAEWTSKGEILTPGPATRLVFDLDPGEGVTMAQLAQVAWAVRDLLAD
IGLSTLPLTSGSKGLHLYTPLDEPVSSKGATVLAKRVAQQLETVMPALVTATMTKSLRAG
KVFLDWSQNSGSKTTIAPYSLRGREQPTVAAPRSWEELDDPGLRQLTYDEVLARLTRDGD
LIAALDADLPGDDRLLKYRSMRNASKTPEPVPRARPVVGQGNTFVIQEHHARRLHYDFRL
ERDGVLVSWAVPKNLPETTSVNHLAVHTEDHPLEYATFEGNIPKGEYGAGKVIIWDSGTY
DTEKFRDDSRNGAEKGEVIVNLHGSRISVRYALIQTNGDQWLAHRMKDQTAFDFDTLAPM
LTSHGSVAGLESGQWAFEGKWDGYRLLVEADHGALRLRSRSGRDVTAEYPQLRSLAADLA
DHHVVLDGELVALDSSGVPSFNEMQNRVRATRIEFWAFDLLFLDGRSLLRARYRDRRKLL
ETLGSAGNLIVPELLPGDGAEALAYSHKRGWEGVIAKRRDSGYQPGRRSSAWIKDKHWNT
QEVVIGGWRVGEGGRSSGIGSLLMGIPGPSGLHFAGRVGTGFTERDLANLKKTLVPLHTD
ESPFDAALPAREAKGVTFVAPTLVGEVRYSEWTPDDRLRQSSWRGLRPDKNPSEVVRE

BLAST