GenomeNet

>mlo:mlr2747 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MAKLYFNYATMNAGKTTMLLQASYNYRERGMTTMLFVAGHYRKGDSGLISSRIGLETEAE
MFRDGDDLFARVAEHHDHTTVHCVFVDEAQFLEEEQVWQLARIADRLNIPVMCYGLRTDF
QGKLFSGSRALLAIADDLREVRTICRCGRKATMVVRLGADGKVARQGEQVAIGKDVYVSL
CRRHWEEEMGRAAPDDFIGFMKS

BLAST