GenomeNet

>mlo:mlr9524 DNA ligase-like protein (A)
MRLKFVAPLMPTLVEKPPEGDAWIHEVKFDGYRSQLIIDEDGTRIYTRNGHDWTAKYSDL
VQEAKSLGAESAIIDGEIIVLNEAGLSDFGELRKAITHRQHDLYFVAFDLLHLNGFDLRD
MALKDRRAGLYAIIPPGLRIQFSDALPGDAKAIFELVDKAGLEGMVSKRKDSKYRSGNST
AWLKIKAYTVDEYELLGVEREAGKPAFALMADRKTGRYVGSAFINSSRAIRERLWKRVQE
HAGSPPKGMKRPGTQWVKPGLIGRVKHLRGEEDLRHASLQDFREE

BLAST