GenomeNet

>mlu:Mlut_00770 cell division protein FtsI/penicillin-binding protein 2; K05364 peptidoglycan glycosyltransferase [EC:2.4.1.129] (A)
MNEAIRRTWTVMAAMILVLALAASVIQVLAADQLKTHALNSRQMFLEFGAPRGPILVDGE
PIAESVPSDDAYHYQRVYHEPELYAPLTGFYSLTYGTAGLEAAMNEQLSGTPTSQFVDRA
MEIITGATPEGDQVELTIDPELQRLAYDALPDGVRASAVVTDPTTGEILAMVSKPSFDPN
ALSSHNPAEAQAAMAAIDQIPGASAYRNRASEQLVSPGSTFKLIDAVAMLESGDYTPDGT
VDIPAAWTLPGTTTELPNYDGSPCNTVGRQTLTWALAQSCNTPFAMAAVELGQDRIREAA
ERFGFNDSFEYPLPVTASVFPSDLDDAALAQSSIGQRDVQATALQMAMVAAGIANDGVVM
EPQLIKAVRRSDLTTVQEFSPRERGRATTPEVAGQVSDMMVSAVEDGILGSVQSDTVRIA
AKSGTAEVGDTGNVHSWITGFDASENPRAAVTIVVEDEPPGVGHQTVVSGMKAIMEAVVT
E

BLAST