GenomeNet

>mlu:Mlut_00770 K05364 penicillin-binding protein A | (GenBank) cell division protein FtsI/penicillin-binding protein 2 (A)
MNEAIRRTWTVMAAMILVLALAASVIQVLAADQLKTHALNSRQMFLEFGAPRGPILVDGE
PIAESVPSDDAYHYQRVYHEPELYAPLTGFYSLTYGTAGLEAAMNEQLSGTPTSQFVDRA
MEIITGATPEGDQVELTIDPELQRLAYDALPDGVRASAVVTDPTTGEILAMVSKPSFDPN
ALSSHNPAEAQAAMAAIDQIPGASAYRNRASEQLVSPGSTFKLIDAVAMLESGDYTPDGT
VDIPAAWTLPGTTTELPNYDGSPCNTVGRQTLTWALAQSCNTPFAMAAVELGQDRIREAA
ERFGFNDSFEYPLPVTASVFPSDLDDAALAQSSIGQRDVQATALQMAMVAAGIANDGVVM
EPQLIKAVRRSDLTTVQEFSPRERGRATTPEVAGQVSDMMVSAVEDGILGSVQSDTVRIA
AKSGTAEVGDTGNVHSWITGFDASENPRAAVTIVVEDEPPGVGHQTVVSGMKAIMEAVVT
E

BLAST