GenomeNet

>mmar:MODMU_0609 K01895 acetyl-CoA synthetase [EC:6.2.1.1] | (GenBank) acsA; Acetyl-coenzyme A synthetase (Acetate--CoA ligase) (Acyl-activating enzyme) (EC:6.2.1.1) (A)
MSETTEAHGLTNPEGGFPPPEALAAAANVGPDVYDRAAADRVGFWEEAARRLDWAQPWDQ
ALDWSNPPFAKWFVGGKLNVAVNCVDRHVDAGHGDQVAYHWIGEPGDTRTLTYAQLKDEV
CKAANALVELGVQAGDRVAIYLPMIPEAVVAMLACARIGAVHMVVFGGFSPDALASRITD
ADAKVVITADGGYRRGAPSALKPNVDEALTKTEGVRSVLVVRRTETDVEWTEGRDVWWHE
LVDRQPAEHEAEAFDAEHPLYIMYTSGTTAKPKGILHTTGGYLTQVSYSHWAVFDIKPDT
DVFWTAADVGWVTGHSYIVYGPLSNRTTSVMYEGTPETPHRGRWWEIVQEYGVTVLYTAP
TTIRTFMKWGEDVPAGFDLSSLRLLGSVGEPINPEAWLWYHTHIGGGRCPIVDTWWQTET
GAHMITPLPAVTTLKPGSAQRPLPGIAASVVDEEGKPIEPGATGYLVLTEPWPAMLRTIW
GDDDRYVDTYWSRYGQGVYFAGDGAKLDEDGDIWLLGRVDDVMNVSGHRISTTEVESALV
SHPTVAEAAVVGATDPTTGQGIVAFVILRGDAVDSGEDLVKTLRQHVRKEIGPIASPRQI
MVVAELPKTRSGKIMRRLLRDVAENRELGDVTTLTDSSVMELISSKLPSSASED

BLAST