GenomeNet

>mmar:MODMU_0888 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) ppc; Phosphoenolpyruvate carboxylase, Carbon dioxide fixing enzyme (EC:4.1.1.31) (A)
MSEATVDVADLHAPDDRESENPLREDIRLLGRVLGEVIGEQAGADVLDLVEATRVEAFRI
RRSEVDRGELAERLAGLEPREANHVIRAFSHFSLLANIAEDVHHERRRRHHRREGSPAQP
GSLAASLQLLDAADLDPAVVARELTGALVVPVVTAHPTEVRRKTVSQVQQQISDLLQRRD
TDDPAWSAHLWREVLTLWQTALLRLSRLRLADEIDEALRYYDLSLFQVVPEINAELRQAL
QQRWPDAGLLATPMLRPGSWIGGDRDGNPFVTADAVRRATTSQAGTALRHHLAELVCLAD
ELSMSDRLVTPTEELYALARAASDDSPFRADEPYRQALRGIYRRLAATALWVLGEVPGPA
PDAVLPAYEAPGELLADLETVDRSLRGHGAGALADDRLARLREAVEVFGFHLCGLDMRQN
SSVHEEVLAELLAWAGVCEDYLALDEPARVALLTGELQLRRPLVRPDAELSELARGELDL
LRAAAEQVALLGPDAIPNYVISMCESVSDVLEVGVLLKEVGLLQLDAAGRPTSPLGISPL
FETIEDLQSAGATLAAMLDHPFYRALVAARGDAQEVMLGYSDSNKDGGYLAANWALYRAE
LALVEVARAGGVRLRLFHGRGGTVGRGGGPSYEAIRAQPPGSVAGALRITEQGEVIAAKY
ASPHLARRNLEALVAATLESTLLDIEGLGEDAEETYALFDDLAARARASYGALVHETPGF
VEWFRAATPIRELAELNIGSRPPSRKAGDKITDLRAIPWVFSWSQARIMLPGWYGTGTAL
ESWVGDSPDRLAQLQDLHARWPFFRTVLSNMGMVLAKTDLELAARYASLVPDAELRDRVF
SQITAEHERSVRMLLAITGDDHLLADNPSLARSIRNRFPYLEPLHHLQVEMLRRRRGGDD
DELVRRCIQLSVNGVATALRNSG

BLAST