GenomeNet

>mmar:MODMU_2075 DNA polymerase LigD, ligase domain-containing protein (EC:6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MAPPDPLATYRAKRDPARTAEPVPAADQPLPVGDDDTFVVQEHHTPRGRTGQRVHWDLRL
ERDGVLKSWAVPKGPPTEPGVNRLAVPTEDHPLEYASFAGTITAGEYGGGQVSIWDAGRY
ATEKWADDHVTVSFDGRRLSGRYVVFRLPDGTWNVRKLDADPVVDAPVAAGVPEDLTPML
AAIGELPRADDPRWGYEFKWDGVRALAHVRGGRVRLRARSGNDVTATYPELHRLPEVLSG
HDAVVDGEVVALDGRGRPDFGLLQGRMHRTGPEVARMAAAAPVTYLVFDLLALDGENLLG
LPYTERRERLDALGLASDRWVTTPWFRGNGEQVQAASLENGLEGVVAKRLDSVYRPGGRG
PDWRKVKNLRTQSVVVGGWRPGEGRRAGGIGSLLVGVHDDTGRLVFAGHVGTGFTARALA
DLAPLLTPRATPPFADALPREVTRDARWVEPLLVGEVRYGEWTREGRLRHPAWRGLRDDV
AAADVVVEP

BLAST