GenomeNet

>mmc:Mmcs_0572 copper/zinc binding superoxide dismutase protein; K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MFAVPALALSACSPNEPVSSEPGTTPSVWTGSPSPSAAPGQGEEGGSGSEGQGEGGQKLT
AELKSPDGTTVANAEFDFSGGYATVTVQTVASGQLEPGFHGMHVHQVGKCEPNSVAPSGG
APGNFNSAGGHFQTEGKTGHPASGDLTSLQVREDGSAMVVTTTDAFTAEDLTGGEGTAII
IHEKADNFANIPPEKYNQVNGTPGPDQATMATGDAGGRVACGVIRSGQ

BLAST