GenomeNet

>mmc:Mmcs_0572 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (GenBank) superoxide dismutase, copper/zinc binding protein (A)
MFAVPALALSACSPNEPVSSEPGTTPSVWTGSPSPSAAPGQGEEGGSGSEGQGEGGQKLT
AELKSPDGTTVANAEFDFSGGYATVTVQTVASGQLEPGFHGMHVHQVGKCEPNSVAPSGG
APGNFNSAGGHFQTEGKTGHPASGDLTSLQVREDGSAMVVTTTDAFTAEDLTGGEGTAII
IHEKADNFANIPPEKYNQVNGTPGPDQATMATGDAGGRVACGVIRSGQ

BLAST