GenomeNet

>mmc:Mmcs_4915 hypothetical protein (A)
MASAATEIDVDGVKVRLTNPDKPYFPKLGKDGTKGKLVDYYLAVADRMVALLRDRPVHLQ
RFPDGIEGEEIYQKRVPQKRPDYLETCTVTFPSGRTADALKITHPSAIAWAAQMGTVTLH
PWQVRCPDTEHPDELRIDLDPQPGTGFAEARSVAVDVLKPLLDELGLVGYPKTSGGRGVH
VFLRIATDWDFIAVRRAGIALAREVERRAPNAVTTSWWKEERGRRLFIDYNQNARDRTFA
SAYSARKTPIATVSTPLTWEELRVAEPDDYTIATVPDFVAGRPDPWADIDKKAQSIDTLL
KMVEADEERGLGDLPYPPNYPKMPGEPPRVQPSKKVAEHWDEDGNRR

BLAST