GenomeNet

>mmh:Mmah_0746 DNA ligase D, 3'-phosphoesterase domain protein (A)
MLEEYRKKRDFDRTSEPEAKGTSRSGEPIFVIQKHDASNLHYDLRLEMNGVLKSWAVPKQ
PPKKAGIKRLAIQTEDHPMEYADFEGEIPEGQYGAGKVEIWDRGNYEAIKIEEKEIIVTL
KGKQLTGDYVLVKTKYGNNDKGWLFFKKKVEN

BLAST