GenomeNet

>mmh:Mmah_0746 DNA ligase D, 3'-phosphoesterase domain protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MLEEYRKKRDFDRTSEPEAKGTSRSGEPIFVIQKHDASNLHYDLRLEMNGVLKSWAVPKQ
PPKKAGIKRLAIQTEDHPMEYADFEGEIPEGQYGAGKVEIWDRGNYEAIKIEEKEIIVTL
KGKQLTGDYVLVKTKYGNNDKGWLFFKKKVEN

BLAST