GenomeNet

>mmm:W7S_18520 K16150 glycogen synthase [EC:2.4.1.11] | (GenBank) glycoside hydrolase family protein (A)
MKILMVSWEYPPVVVGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRSHPSSDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHSMVRAGLSLKKPGSSHAWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSGSMAD
EITELFGPGLAEITVICNGIETARWPFAARRPRTGPAELLYLGRLEYEKGVHDVIAALPR
VRRTHAGTTLTIAGEGTQQGWLIEQARKHRVLKAIRFVGHLEHAELLAVLHRADAAVLPS
HYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGRTGVSCPPRDVTRLAAAIRTVLDDPR
AAQQRARAARERLTSDFDWRTVADKTAQVYLSAKRGERQPQARLPIVEHALPDR

BLAST