GenomeNet

>mmm:W7S_23065 superoxide dismutase ,Fe-Zn 1 family protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MPHYVLPDLTYDYGALEPAISGEIMQLHHDAHHAAYVKGANSTVDQLAEARAERNLAHLP
GLERTLAFHLAGHALHSIFWTNLSPEAAERPEGELAAAIDEFFGGFEAFRAEMTGATSSV
QGSGWGALAWDPIGRRLVVHQIHDHHVSVAITSTPLLVFDAWEHAFYLQYRNVKADYVDR
LWSIVNWADVAVRFEAARRGDLSGLHSSDEIGGAR

BLAST