GenomeNet

>mmu:18193 Nsd1, AI528500, KMT3B; nuclear receptor-binding SET-domain protein 1 (EC:2.1.1.43); K15588 histone-lysine N-methyltransferase NSD1 [EC:2.1.1.43] (A)
MDRTCELSRRNCLLSFSNPVNLDASEDKDSPFGNGQSNFSEPLNGCTMQLPTAASGTSQN
AYGQDSPSCYIPLRRLQDLASMINVEYLSGSADGSESFQDPAKSDSRAQSPIVCTSLSPG
GPTALAMKQEPTCNNSPELQLRVTKTTKNGFLHFENFTGVDDADVDSEMDPEQPVTEDES
IEEIFEETQTNATCNYEPKSENGVEVAMGSEQDSMPESRHGAVERPFLPLAPQTEKQKNK
QRSEVDGSNEKTALLPAPTSLGDTNVTVEEQFNSINLSFQDDPDSSPSPLGNMLEIPGTS
SPSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVANRR
PYREYYVEAFGDPSEKAWVAGKAIVMFEGRHQFEELPVLRKRGKQKEKGYRHKVPQKILS
KWEASVGLAEQYDVPKGSKNQKCVSSSVKLDSEEDMPFEDCTNDPDSEHLLLNGCLKSLA
FDSEHSADEKEKPCAKSRVRKSSDNIKRTSVKKDLVPFESRKEERRGKIPDNLGLDFISG
GVSDKQASNELSRIANSLTGSSTAPGSFLFSSSVQNTAKTDFETPDCDSLSGLSESALIS
KHSGEKKKLQPGQVCSSKVQLCYVGAGDEEKRSNSVSVSTTSDDGCSDLDPTEHNSGFQN
SVLGITDAFDKTENALSVHKNETQYSRYPVTNRIKEKQKSLITNSHADHLMGSTKTMEPE
TAELSQVNLSDLKISSPIPKPQPEFRNDGLTTKFSAPPGIRNENPLTKGGLANQTLLPLK
CRQPKFRSIKCKHKESPAVAETSATSEDLSLKCCSSDTNGSPLANISKSGKGEGLKLLNN
MHEKTRDSSDIETAVVKHVLSELKELSYRSLSEDVSDSGTAKASKPLLFSSASSQNHIPI
EPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLASYRTPDRGDCSSGSPVGTSKVLVLGSS
TPNSEKPGDSTQDSVHQSPGGGDSALSGELSSSLSSLASDKRELPACGKIRSNCIPRRNC
GRAKPSSKLRETISAQMVKPSVNPKALKTERKRKFSRLPAVTLAANRLGNKESGSVNGPS
RGGAEDPGKEEPLQQMDLLRNEDTHFSDVHFDSKAKQSDPDKNLEKEPSFENRKGPELGS
EMNTENDELHGVNQVVPKKRWQRLNQRRPKPGKRANRFREKENSEGAFGVLLPADAVQKA
REDYLEQRAPPTSKPEDSAADPNHGSHSESVAPRLNVCEKSSVGMGDVEKETGIPSLMPQ
TKLPEPAIRSEKKRLRKPSKWLLEYTEEYDQIFAPKKKQKKVQEQVHKVSSRCEDESLLA
RCQPSAQNKQVDENSLISTKEEPPVLEREAPFLEGPLAQSDLGVTHAELPQLTLSVPVAP
EASPRPALESEELLVKTPGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSRKCFEAS
RSGNGIVESRATSHLKEFSGGTTKIFDKPRKRKRQRLVTARVHYKKVKKEDLTKDTPSSE
GELLIHRTAASPKEILEEGVEHDPGMSASKKLQVERGGGAALKENVCQNCEKLGELLLCE
AQCCGAFHLECLGLPEMPRGKFICNECHTGIHTCFVCKQSGEDVKRCLLPLCGKFYHEEC
VQKYPPTVTQNKGFRCPLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGS
KILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIP
EGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFF
GSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQE
DRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYE
CHPTVCPAGVRCQNQCFSKRQYPDVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEE
ECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTR
VGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIVTEEKSRKF
KRKPHGKRRSQGEVTKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWEC
PWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIR
EYVPPTATSPPSPGTQPKEQSSEMATQGPKKSDQPPTDATQLLPLSKKALTGSCQRPLLP
ERPPERTDSSSHLLDRIRDLAGSGTKSQSLVSSQRPQDRPPAKEGPRPQPPDRASPMTRP
SSSPSVSSLPLERPLRMTDSRLDKSIGAASPKSQAVEKTPASTGLRLSSPDRLLTTNSPK
PQISDRPPEKSHASLTQRLPPPEKVLSAVVQSLVAKEKALRPVDQNTQSKHRPAVVMDLI
DLTPRQKERAASPQEVTPQADEKTAMLESSSWPSSKGLGHIPRATEKISVSESLQPSGKV
AAPSEHPWQAVKSLTHARFLSPPSAKAFLYESATQASGRTPVGAEQTPGPPSPAPGLVKQ
VKQLSRGLTAKSGQSFRSLGKISASLPNEEKKLTTTEQSPWGLGKASPGAGLWPIVAGQT
LAQACWSAGGTQTLAQTCWSLGRGQDPKPENAIQALNQAPSSRKCADSEKK

BLAST