GenomeNet

>mmu:208043 Setd1b, AA516740, BC035291, KMT2G, mKIAA1076; SET domain containing 1B (EC:2.1.1.43); K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MENSHPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMSS
NRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNVRENFLRD
MCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDTK
GETRMRFYELLVTGRYTPQTLPVGELDAISPIVSETLQLSDALKRLKDGSLSAGCGSGSS
SVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPITPRLGTPFSQDSSYSSRQPTPSYLFS
QDPTATFKARRHESKFTDAYNRRHEHHYVHNSAVAGATAPFRGSSDLSFGTVGSSGTPFK
AQSQDATTFAHTPPPAQTATASGFKSAFSPYQTPAPPFPPPPEEPTATAAFGSRDSGEFR
RAPAPPPLPPAEPPAKEKPGTPPGPPPPDSNSMELGGRPTFGWSPEPCDSPGTPTLESSP
AGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTEIQMEGSPISSSSSQLSPLSHFGTN
SQPGFRGPSPPSSRPSSTGLEDISPTPLPDSDEDEDLGLGLGPRPPPEPGPPDPMGLLGQ
TAEVDLDLAGDRTPTSERMDEGQQSSGEDMEISDDEMPSAPITSADCPKPMVVTPGAGAV
AAPNVLAPNLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPPPPPPAHPAVTVPPPP
LPAPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQTQMLSRLMTGQ
GACPYPPFMAAAAAAASAGLQFVNLPPYRSPFSLSNSGPGRGQHWPPLPKFDPSVPPPGY
IPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKKERMAKASLT
PVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAIRLPSFKVKRKEP
PDTASSGDQKRLRPSTSVDEEDEESERERDRDIADAPCELTKRDPKSVGVRRRPGRPLEL
DSGGEEDEKESLSASSSSSASSSSGSSTTSPSSSASDKEEEDRESTEEEEEEEEEEAEEE
EEEGPRSRISSPSSSSSSDKDDEDDNEADSDGQIDSDIDDQGAPLSEASEKDNGDSEEEE
TESITTSKAPAESSSSSSESSGSSEFESSSESESSSSSSEDEEEMTVPGVEEEEEEEEEE
EKETAMAAATVVAMAEESMPPAGGQDFEQDRAEVPLGPRGPMRESLGTEEEVDIEAEDEV
PEMQAPELEEPPLPMGARKLEGSPEPPEEPGPNTQGDMLLSPELPARETEEAQLPSPPEH
GPESDLDMEPEPPPMLSLPLQPPLPPPRLLRPPSPPPEPETPEPPKPPVPLEPPPEDHPP
RTPGLCGSLAKSQSTETVPATPGGEPPLSGSSSGLSLSSPQVPGSPFSYPSPSPGLSSGG
LPRTPGRDFSFTPTFPEPSGPLLLPVCPLPTGRRDERTGPLASPVLLETGLPLPLPLPLP
LPLALPVPVLRAQPRPPPQLPPLLPATLAPCPTPIKRKPGRPRRSPPSMLSLDGPLVRPP
PGPALGRDLLLLPGQPPAPIFPSAHDPRAVTLDFRNTGIPAPPPPLPPQPPPPPPPPPVE
STKLPFKELDNQWPSEAIPPGPRRDEVTEEYVDLAKVRGPWRRPPKKRHEDLVAPSASPE
PSPPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVY
HPSTSLSSAKKKKREDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPMDTQGM
SIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGL
FAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFA
RFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENC
RGTLN

BLAST