GenomeNet

>mmu:217246 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) Ace3, EG217246; angiotensin I converting enzyme (peptidyl-dipeptidase A) 3 (A)
MNLPWALLLVLLSHRQLLPWLRTVGETSLNDFYSEAQAKLFLQFYEQTAQVVLNEFMEAT
WNYVTNITKQNQKNMLQKEADRSQFMLYFSTRARMFRTDHFLNQDVKRMLRKLQNIDKSA
LPTEDLLEYNRLLTYMETAYNRAEVCLDEGPCLTLEPDLQEIMATSRDQKELLWAWQGWR
DAVGRQLRPVFEDYVRLSNKAAQYNGYKDMGALWRSKYESDTLEEDLEQLYKELQPLYLN
LHAYVRRSLYRYYGPELIDLRGPIPAHLLGNMWAQSWNNILDLVLPYPTKAPEDITAIMK
IQHWRPEKMFEEANLFFTSMGMLPAPPAFWIKSMMEKPADGREVECHTSSWNFYKFNDFR
VKKCTEVTLEDLLSVFHQMGHIQYFLQYQNLSVIYQEGASPAFEEAVGSVIALSVSSHKY
LLARGLLSQPHQDSEEEVNFLLGIALEKIAFIPFSYLVDKFRWKIFDGTISKITYNQEWW
NFRLKYQGLCPPVPRSDDDFDPGAKFHIPANVPYIRYFLGLILQFQLHEALCEASGHVGP
LHQCDNYNSKVAGKILGDLLKLGSSRPWREVLQEVTGESNISTKAFLTYFKPLMDWLVTE
NVKQGDTLGWPDFSCSFEEKITSKVSFLGTDTEPEQAYLGQWVLLSMSFFMLVLILALGF
RLHYLEKQLLDEDTMILKTLPYSYFLGIAMEPHQAARKQWLLLGLCCILMLCCIGLLIRI
VTQNTENTPWMKNEGQS

BLAST