GenomeNet

>mmu:21816 K05619 transglutaminase 1 [EC:2.3.2.13] | (RefSeq) Tgm1, 2310004J08Rik, Tgase1; transglutaminase 1, K polypeptide (A)
MEGPRSDVGRWGRSPWQPPTTPSPEPEPVPEPDRRSRSRRGGGRSFWARCCGCCSCGNRG
DDDWGPEPSGSRSRGTSSRGRDSRGGRRPESRGSGVNAAGDGTIREGMLVVTGVDLLCSR
SDQNRREHHTDEFEYDELIVRRGQPFHMILFLNREYESSDRIALELLIGSNPEVGKGTHV
IIPVGKGGSGGWKAQVTKNNGHNLNLRVHTSPNAIIGKFQFTVRTRSEAGEFQLPFDPRN
EIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDAC
LYILDRRGMPYGGRGDPVSVSRVVSAMVNSLDDNGVLIGNWTGDYSRGTNPSAWVGSVEI
LLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGFATRTVTNFNSAHDTDTSLTMDIYFDENM
KPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESVK
NGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIHSNNREDIT
HIYKHPEGSEAERRAVEKAAAHGSKPNVYATRDSAEDVAMQVEAQDAVMGQDLAVSVVLT
NRGSSRRTVKLHLYLCVTYYTGVSGPTFKEAKKEVTLAPGASDSVTMPVAYKEYKPHLVD
QGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECGVQIVFKNPLPVTL
TNVVFRLEGSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGV
IQVDVAPASGGSGFSDAGGDSRSGENIPMAYRGGA

BLAST