GenomeNet

>mmu:21818 K05620 transglutaminase 3 [EC:2.3.2.13] | (RefSeq) Tgm3, AI893889, TG_E, TG(E), TGE, TGase_E, TGase-3, we; transglutaminase 3, E polypeptide (EC:2.3.2.13) (A)
MSALQIQNVNWQVPMNRRAHHTDKFSSQDSIVRRGQPWEIILVCNRSLESGEDLNFIVST
GPQPSESARTKAVFSISGRSTGGWNAALKANSGNNLAIAIASPVSAPIGLYTLSVEISSR
GRASSLKLGTFIMLFNPWLQADDVFMSNHAERQEYVEEDSGIIYVGSTNRIGMVGWNFGQ
FEEDILNISLSILDRSLNFRRDPVTDVARRNDPKYVCRVLSAMINGNDDNGVISGNWSGN
YTGGVDPRTWNGSVEILKNWKKSGFRPVQFGQCWVFAGTLNTVLRCLGVPSRVITNFNSA
HDTDRNLSVDVYYDAMGNPLEKGSDSVWNFHVWNEGWFVRTDLGPTYNGWQVLDATPQER
SQGVFQCGPASVNAIKAGDVDRNFDMIFIFAEVNADRITWIYNNRNNTQKQNSVDTHSIG
KYISTKAVGSNSRMDVTDKYKYPEGSSEERQVHQKALDKLKPNASFGATSSRNPEGEDKE
PSISGKFKVTGILAVGKEVSLSLMLKNMTNDRKTVTMNMTAWTIVYNGTLVHEVWKDSAT
ISLDPEEEIQYPVKIAYSQYERYLKADNMIRITAVCKVPDEAEVVVERDVILDNPALTLE
VLEQAHVRKPVNVQMLFSNPLDQPVNNCVLLVEGSGLLRGSLKIDVPSLRPKEKSRIRFE
IFPTRSGTKQLLADFSCNKFPAIKAMLPIDVSE

BLAST