GenomeNet

>mmu:21818 Tgm3, AI893889, TG_E, TG(E), TGE, TGase_E, TGase-3; transglutaminase 3, E polypeptide (EC:2.3.2.13); K05620 transglutaminase 3 [EC:2.3.2.13] (A)
MSALQIQNVNWQVPMNRRAHHTDKFSSQDSIVRRGQPWEIILVCNRSLESGEDLNFIVST
GPQPSESARTKAVFSISGRSTGGWNAALKANSGNNLAIAIASPVSAPIGLYTLSVEISSR
GRASSLKLGTFIMLFNPWLQADDVFMSNHAERQEYVEEDSGIIYVGSTNRIGMVGWNFGQ
FEEDILNISLSILDRSLNFRRDPVTDVARRNDPKYVCRVLSAMINGNDDNGVISGNWSGN
YTGGVDPRTWNGSVEILKNWKKSGFRPVQFGQCWVFAGTLNTVLRCLGVPSRVITNFNSA
HDTDRNLSVDVYYDAMGNPLEKGSDSVWNFHVWNEGWFVRTDLGPTYNGWQVLDATPQER
SQGVFQCGPASVNAIKAGDVDRNFDMIFIFAEVNADRITWIYNNRNNTQKQNSVDTHSIG
KYISTKAVGSNSRMDVTDKYKYPEGSSEERQVHQKALDKLKPNASFGATSSRNPEGEDKE
PSISGKFKVTGILAVGKEVSLSLMLKNMTNDRKTVTMNMTAWTIVYNGTLVHEVWKDSAT
ISLDPEEEIQYPVKIAYSQYERYLKADNMIRITAVCKVPDEAEVVVERDVILDNPALTLE
VLEQAHVRKPVNVQMLFSNPLDQPVNNCVLLVEGSGLLRGSLKIDVPSLRPKEKSRIRFE
IFPTRSGTKQLLADFSCNKFPAIKAMLPIDVSE

BLAST