GenomeNet

>mmu:233904 K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] | (RefSeq) Setd1a, BC010250, KMT2F, Nsccn1, mKIAA0339, mNSC1; SET domain containing 1A (A)
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVSDSKYTPVEDL
QDPRCHVRSKARDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAAAETTEARRRSSSDTAAYPAGTTVGGTPGNG
TPCSQDTNFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSTSSAPATTATATSATAAATAASSSSSSSSSSSSSSSSSSSASQFR
GSDSSYPAYYESWNRYQRHTSYPPRRATREDPSGASFAENTAERFPPSYTSYLAPEPNRS
TDQDYRPPASEAPPPEPPEPGGGGGGSGGGGGGGGGGGGGAPSPEREEARTPPRPASPAR
SGSPAPETTNESVPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSSAGPGARDAG
AEVPSGAGHGPCTPPPAPANFEDVAPTGSGEPGAARESPKANGQNQASPCSSGEDMEISD
DDRGGSPPPAPTPPQQPPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEY
PPPPPPPPPHIYDFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLTAASAG
PPGGAFGEAFLPFPPPQEAAYGLPYALYTQGQEGRGSYSREAYHLPLPMAAEPLPSSSVS
GEEARLPHREEAEIAESKVLPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQ
WWESKEEKAKPFQNAAKQQAKEEDKEKMKLKEPGMLSLVDWAKSGGITGIEAFAFGSGLR
GALRLPSFKVKRKEPSEISEASEEKRPRPSTPAEEDEDDPEREKEAGEPGRPGTKPPKRD
EERGKTQGKHRKSFTLDSEGEEASQESSSEKDEDDDDEDEEDEEQEEAVDATKKEAEASD
GEDEDSDSSSQCSLYADSDGENGSTSDSESGSSSSSSSSSSSSSSSSSSESSSEEEEQSA
VIPSASPPREVPEPLPAPDEKPETDGLVDSPVMPLSEKETLPTQPAGPAEEPPPSVPQPP
AEPPAGPPDAAPRLDERPSSPIPLLPPPKKRRKTVSFSAAEEAPVPEPSTAAPLQAKSSG
PVSRKVPRVVERTIRNLPLDHASLVKSWPEEVARGGRNRAGGRVRSTEEEEATESGTEVD
LAVLADLALTPARRGLATLPTGDDSEATETSDEAERPSPLLSHILLEHNYALAIKPPPTT
PAPRPLEPAPALAALFSSPADEVLEAPEVVVAEAEEPKQQLQQQHPEQEGEEEEEDEEEE
SESSESSSSSSSDEEGAIRRRSLRSHTRRRRPPLPPPPPPPPSFEPRSEFEQMTILYDIW
NSGLDLEDMSYLRLTYERLLQQTSGADWLNDTHWVQHTITNLSTPKRKRRPQDGPREHQT
GSARSEGYYPISKKEKDKYLDVCPVSARQLEGGDTQGTNRVLSERRSEQRRLLSAIGTSA
IMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMRE
KRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSK
QPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN

BLAST