GenomeNet

>mmu:234135 K11425 histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43] | (RefSeq) Nsd3, 6720429E03, A530023P05, AI528490, WHISTLE, Whsc1l1; nuclear receptor binding SET domain protein 3 (A)
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNHSDIVEDGGPTPFEATLQQGFQYP
PTTEDLPPLTNGYPPSISLYETQTKYPPYNQYPNGSANGFGAVRNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPLPPPPPPPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFES
SLCGDLLNEVQASEHTKSKHESRKEKRKKSNRHESSRSEERRSHKIPKLEPEGQNRPNER
VDTAPEKPREEPVLKEAIPVQPILSSVPTTETSTGVKFQVGDLVWSKVGTYPWWPCMVSS
DPQLEVHSKINTRGAREYHVQFFSNQPERAWVHEKRVREYKGHEQYEELLAEAAKQASNH
SEKQKIRKPRPQRERAQWDIGIAHAEKALKMTREERVEQYTFIYIDKQPEEASSQAKKNV
TSKTEVKKPRRPRSVLNSQPEQTNAGEVASSQSSTDLRRQSQRRHTSLEEEEPPPVKIAW
KTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIG
NKTEISVRGQDRLIISSPSQRSEKPAQSASSPEATSGSAGPVEKKQQRRSIRTRSESEKS
AEVVPKKKIKKEQVETAPQASLKTGLQKGSADRGAQGSVRFSDSSVSAAKEETVD

BLAST