GenomeNet

>mmu:235626 Setd2, 4921524K10Rik, BC031601, KMT3A; SET domain containing 2 (EC:2.1.1.43); K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] (A)
MKPLPSQQPPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPVFKGVASSRFLPKGT
KTKVNLEEQGRQKVSFSFSFTKKTLQNRFLTALSNEKQSDSPNSPAPPLQVDSNPKVKMD
AGDTFPATEESSPPKSRVELGRIHFKKHLLHVTSRPQLAASTTAASPLPPTTQLPAVLAE
SMIDSPPSSPPPPPPPPQASSPSPPAQISEPVALPQPPATALMTSPPGPLPGDVAVRAQK
ESPVKSGPEVLEVDTKQDIVSNSLEEHTVQTLKEQADHLLQKEDSHIGKEEEVSDGSKIS
LSSKKASSKKKSSQFEGTFLGSESDEDSVRTSSSQRSHDLKSSTSIDKERDFKKSSAPSK
SEDLGKSSRSKTERDDRYCSYSKLERDTRYVSSRCRSERDRRRSRSRSRSDRASRTSLSY
SRSERSHYYDSERRYHRSSPYRERTRYSRPYTDNRARESSDSEDEYKKTYPRRTSAHSYR
DLRTSSSYSKFDRDCKTETSYLEMERRGKYTSKLERESKRTSEHETIKRCCSPPNELGFR
RGSSYSKHDNSTSRYKSALSKSISKNDKFKNSFCCTELNEENKQSHSFSLQTPCSKGSEL
RTINKISEREKTGSPTPSNQLNDSPTFKKLDESPVLKPEFIGHDGRESIKELELSKVKND
QLRNFCSIELNVNGSPETEADVATFCTSKTDAISMTSDDSVTGSEVSPLIKACMLSSNGF
QNVGRCRERDSDDTCRQHNTSKSPFREMEPLLSPHHDKLMSLPVKTIDYPKTLIKEPVDK
RHSCCKTKDSDIYCSPNENPEAENAEPSAMTISSHSFVNVHLESKTVICDNREPTDRHSE
NTCDEYKQSIGSTSSASHNHFDGLYEPIGSSGISSLQSPPSGIRCEENTSPTLDAVESKK
GIDFLKYARKETDVGSALPDSGKGFSWENRHNNVLSGQSLQEAQEEGNSILHERRGRPEI
PLDEEQRGHTHISDDSEVVFPYDLNLTMEDSDGITYTLKCDSSGNAPEIVSTVHEDYSGS
SASSSDESDSEDTESDDSSIPRNRLQSVVVVPKNSTLPMEETSPCSSRSSQSYKHYSDRW
EDGLETRRHAYEEEYESKGCSQTEKYFLHKGTERSAESCYSQFGRKADNHLPDIAHAQSD
GVDSTSQTDSRSDHLGHLNPEDTLRAKTSRPQELPVYSDDFEDLPNKSRQQMIFSNRPDS
SRLGKTELSFSSSCDISRMDGLHSSEELRNLGWDFSQQERPTTTYQQPDSSYGTCGTHKY
QQSTEHYGGTHNYWQGNGYWDPRSAGRPPGTGLAYDRIQGQVPDSLTDDREEEEHWDQRS
GSHFSSPSNKFFFHQKDKGSVQAPEISSNSIKDALVMNERKDFSKNFEKNDIKERGPPKK
RRQELESDSESDGELQARKKVRVEMEQGESSVPQHSELMGPSCAMDDFRDPQRWKEFAKL
GKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGEVACGEDCLNRLLM
IECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDH
KEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQL
RVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKK
ERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSC
LKSFLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQR
WSQTKTAVPQLSEGDGYSSENTSRAHTPLNTPDPSAKPSTEMDTDTPKKLIFRRLKIISE
NSMDSAVSDVTSELECKDGKEDLDQLETVTVEEDEELQSQQLLPQQLCESKVESEATIEV
SKLPTSEPEADTETEPKDSNGTKLEETIAEETPSQDEEEGVSDVESERSQEPPDKTVDIS
DLATKLLDSWKDLKEVYRIPKKSQTEKESTVAERGRDAAAFRDQTAPKTPNRSRERDPDK
QSQNKEKRKRRGSLSPPSSAYERGTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQ
EVAQREAQKQQQQMQNLGMTSPLPFDSLGYNASHHPFAGYPPGYPMQAYVDPSNPNAGKV
LLPTPSMDPVCSPAPYDHAQPLVGHSTESLAAPPSVPVVPHVAASVEVSSSQYVAQNESV
VHQDSNVPVMPVQAPGPVQGQNYNVWESNQQSVSVQQQYSPAQSQTTIYYQGQTCSTVYS
VTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVVVQPTAAVTSIVAPGQPQSLQPP
EMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGD
DASLEHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLN
PYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKY
MQKFGAVYKPKEDTELE

BLAST