GenomeNet

>mmu:239122 K18494 histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43] | (RefSeq) Setdb2, Clld8, Gm293, KMT1F; SET domain, bifurcated 2 (A)
MEEKNGDAKTFWMELQDDGKVDLMFEKTQNVLHSLKQKIKDGSATNGDYVQAMNLVNEAT
LSNTQTLEKDHTPVTQSEQENKSSAVPSASCDNSCPKGCTIPSPGKKVFLPVKNKADNLV
KKEAPLHISFHRHICSRTCLMETPLSLKGENPLQLPIRCHFQRRHAKTNSHSSALHVNYK
TPCGRNLRNMEEVFHYLLETECNFLFTDNFSFNTYVQLTRNHPKQNEVVSDVDISNGVES
VSIPFCNEIDNSKLPRFKYRNTVWPRIYHLNFSNMFSDSCDCSEGCIDIKKCACLQLTAK
NAKACPLSSDGECAGYKYKRLQRLIPTGIYECNLLCKCNKQMCQNRVIQHGVRVRLQVFK
SEKKGWGVRCLDDIDKGTFVCIYSGRLLRRATPEKTNIGENGREQQHIVKNSFSKKRKLE
VVCSDCDAHCDSPKAEDCPPKLSGDLKEPAVEMNHRNISRTQHHSVIRRTKSKTTVFHYS
EKNMGFVCSDSAAPEDKNGFKPAQEHVNSEARRAHEDLSSNPAGDSEDTQLTESDVIDIT
ASREDSAPAYRCKHATIVDRKDTKQVLEVPGKKSQEEEPAASQSQQALCDEELPSERTKI
PSASLMQLSKESLFLLDASKEGNVGRFLNHSCCPNLWVQNVFVETHDRNFPLVAFFTNRY
VKARTELTWDYGYEAGATPAKEILCQCGFNKCRKKLI

BLAST