GenomeNet

>mmu:394435 Ugt1a6b, A9', Ugt1a9; UDP glucuronosyltransferase 1 family, polypeptide A6B; K00699 glucuronosyltransferase [EC:2.4.1.17] (A)
MACLLPAAQTLPAGFLFLVLWASVLGDKLLVVPQDGSHWLSMKEIVEHLSERGHDIVVLV
PEVNLLLGESKYYRRKIFSVPYSLEELQTRFRTFGRNQFVPGAPLMGPLREYRNSMLTLE
MFFSNCQSLLKDSATLSFLRENKFDALFTDPAMPCGVILAEYLNLPSVYLFRGFPCSLEH
MLGQSPSPVSYVPRFYTKFSDHMTFPQRLANFIVNILENYLYYCLYSKYEIIVTDLLKRD
VSLPSLHQNSLWLLRYDFVFEYPRPIMPNMIFIGGINCKKKGKLTQEFEAYVNASGEHGI
VVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLG
HPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADD
LENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLT
WYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH

BLAST