GenomeNet

>mmu:67680 K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] | (RefSeq) Sdhb, 0710008N11Rik; succinate dehydrogenase complex, subunit B, iron sulfur (Ip) (A)
MAATVGVSLKRGFPAAVLGRVGLQFQACRGAQTAAAAAPRIKKFAIYRWDPDKTGDKPRM
QTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRID
TDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDRE
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPF
SVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA

BLAST