GenomeNet

>mmu:67956 Setd8, 2410195B05Rik, AA617402, AW536475, PR-SET7; SET domain containing (lysine methyltransferase) 8 (EC:2.1.1.43); K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] (A)
MARGRKMCKPRAVEAAAAAVAATAPGPEMVEQRGPGRPRSDGENVFAGQSKIYAYMSPNK
CSAMRSPLQEENSVAHHEVKCPGKPLAGIYRKREEKRNTGNVIRSAVKSDEQKSKDTRRG
PLAPFPNQKSEAAEPPKTPPPSCDSTNVAVAKQALKKSLKGKQAPRKKSQGKTQQNRKLT
DFYPVRRSSRKSKAELQSEERKKIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFV
VEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATQETNRLGRLINHSKC
GNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH

BLAST