GenomeNet

>mmu:73251 Setd7, 1600028F23Rik, H3K4MT, KMT7, Set7, Set7/9, mKIAA1717; SET domain containing (lysine methyltransferase) 7 (EC:2.1.1.43); K11431 histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43] (A)
MDSDDEVVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDSDGRLIFKGQYKDNNRHGVCW
IHYPDGGSLVGEVNEDGEMTGEKIAYVYPDQRTALYGKFIDGEMLEGKLATLMATEEGRP
HFEVTSGSSVYHFDKSTSSCISSDALLPDPYESERVYVADSLISSAGEGLFSKVAVGPNT
VMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFT
PNCVYDLFVHPRFGPIKCIRTLRAVEAEEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
QATQQK

BLAST