GenomeNet

>mmu:74145 F13a1, 1200014I03Rik, AI462306, F13a; coagulation factor XIII, A1 subunit (EC:2.3.2.13); K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] (A)
MSDTPASTFGGRRAVPPNNSNAAEVDLPTEELQGLVPRGVNLKDYLNVTAVHLFKERWDS
NKIDHHTDKYDNNKLIVRRGQTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPV
PVVKELQSGKWGAKVIMNEDRSVRLSVQSSPECIVGKFRMYVAVWTPYGILRTRRDPETD
TYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFYGDFKDIKSRSWSYGQFEDGILDTCL
YVMDKAEMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYAYGIPPSAWTGSVDIL
LEYRSSETPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGN
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLVYITAKQDGTHVVEAVDATHIGKLIVTKQIGGDGMQDITD
TYKFQEGQEEERLALETALMYGAKKTLNTEGVVKSRSDVTMNFDVENAVLGKDFKVTITF
QNNSSNLYTILAYLSGNITFYTGVSKKEFKKESFEETLDPFSSKKKEVLVRAGEYMSHLL
EQGFLHFFVTARINESRDVLAKQKSIILTIPKITIKVRGAAMVGSDMVVTVEFTNPLKET
LQNVWIHLDGPGVMRPKRKVFREIRPNTTVQWEEVCRPWVSGHRKLIASMTSDSLRHVYG
ELDLQIQRRPTM

BLAST