GenomeNet

>mmu:74729 K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] | (RefSeq) Setmar, 5830404F24Rik, Etet2; SET domain without mariner transposase fusion (A)
MSAEGVEKLSLEIAASEEESVAPTEQQDVACGLENLPVSLWPLGAEPRPKPFQYTPDHVA
GPGADIDPTQITFPGCACIETPCVPGTCSCLRHENNYDDNLCLRDVGSEGKYAKPVFECN
VLCQCGMRCRNRVVQNGLHFLLQVFQTEKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQ
RRIHLQTSHDSNYIIAVREHIYSGQIMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDS
MVPKLALFAAKDILPGEELSYDYSGRFLNQVSSKDKEKIDCSPPRKPCYCGAQSCTTFLP
YDSSLYMAP

BLAST