GenomeNet

>mmu:74729 Setmar, 5830404F24Rik, Etet2; SET domain without mariner transposase fusion (EC:2.1.1.43); K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] (A)
MDRSISFIPVGHPCTAKVYTPDHVAGPGADIDPTQITFPGCACIETPCVPGTCSCLRHEN
NYDDNLCLRDVGSEGKYAKPVFECNVLCQCGMRCRNRVVQNGLHFLLQVFQTEKKGWGLR
TLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTSHDSNYIIAVREHIYSGQIMETFVDPTY
IGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDILPGEELSYDYSGRFLNQVSSKD
KEKIDCSPPRKPCYCGAQSCTTFLPYDSSLYMAP

BLAST