GenomeNet

>mmy:MSC_0185 K01155 type II restriction enzyme [EC:3.1.21.4] | (RefSeq) restriction endonuclease (EC:3.1.21.4) (A)
MLGMNAYDVIYKKIKEIANKYSNKLNSQFQKRIVEMQNDDKSHHLIYRVLGIPYDVGNEI
DYYQNQVRFLYKYAGSFLEEVTILCFKEKYPFASKTKVKNTISNIPKTFEIDCLVNNNAY
EIKWRDATTDNDHIIKEHTRVKTLISYNYKPIRIMFYYPNRVNSMRIQETLETLYKGVGG
EYYYGDSAWSYVKKLQE

BLAST