GenomeNet

>mmy:MSC_0215 K01155 type II restriction enzyme [EC:3.1.21.4] | (RefSeq) sau96I-like; type 2 site-specific deoxyribonuclease (A)
MSNEFILDFISKQDFEKHVTDTINQYKESLKSISLKKLNRNIVDPIKLIFDKNIFNKEFK
EIIELEISRQRDKTNNNVIGYFHQNIFKYIKNCKVPPQGWDVIFQSSEYTYYVEMKNKHN
TMNSVTASGIYMKMQNHLLNYDNNEKSVCALVEVIAKRSQNIPWVMKIKNQKPIGNRRIK
RISIDKFYEIVTGIKDSFKNLCLQLPITLEKLVSENVFLKVEKDTVFEELSKINNDIVLA
LYKLAFSTYEGFEF

BLAST