GenomeNet

>mmy:MSC_0215 sau96I-like; type II site-specific deoxyribonuclease (Sau96I-li (EC:3.1.21.4); K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MSNEFILDFISKQDFEKHVTDTINQYKESLKSISLKKLNRNIVDPIKLIFDKNIFNKEFK
EIIELEISRQRDKTNNNVIGYFHQNIFKYIKNCKVPPQGWDVIFQSSEYTYYVEMKNKHN
TMNSVTASGIYMKMQNHLLNYDNNEKSVCALVEVIAKRSQNIPWVMKIKNQKPIGNRRIK
RISIDKFYEIVTGIKDSFKNLCLQLPITLEKLVSENVFLKVEKDTVFEELSKINNDIVLA
LYKLAFSTYEGFEF

BLAST