GenomeNet

>mok:Metok_0562 Y414 protein; K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] (A)
MDIDILKVSERLKLDEVDIKKAFERKIISFDMYHNKKYLLFKKKLRHIERGTVLFLNNNM
DIVMGYPKIRRAMMLYPTLKNYFINKIVVEEKLDGYNVRITKIDNKVMAITRGGRICPFT
TKKALKFLNVNILDDYPNLMLCGEMIGLNNPYVPHYYPEVNNILIKSDKNNNKKTKIIEN
LGFYIFDVRYRETNKPLSISEKEELLQKYELPYVKPIGIFNKEDIEHIKKIILTLNDKKR
EGVVLKDPDMIINPIKYTTHYTQCNDLSVAFRYMYDLGIDFMFSRLVREGYQSFEFNEDE
KEMEKRAKNIGKSILYPMVNSIKNISKGELITEDFEIYLDSEEDLNEFLDYLKKLHIAFV
VKENQKFENGMHKVKIGRIYNSTNDKIKSHLDGNLW

BLAST