GenomeNet

>mok:Metok_0562 K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] | (GenBank) Y414 protein (A)
MDIDILKVSERLKLDEVDIKKAFERKIISFDMYHNKKYLLFKKKLRHIERGTVLFLNNNM
DIVMGYPKIRRAMMLYPTLKNYFINKIVVEEKLDGYNVRITKIDNKVMAITRGGRICPFT
TKKALKFLNVNILDDYPNLMLCGEMIGLNNPYVPHYYPEVNNILIKSDKNNNKKTKIIEN
LGFYIFDVRYRETNKPLSISEKEELLQKYELPYVKPIGIFNKEDIEHIKKIILTLNDKKR
EGVVLKDPDMIINPIKYTTHYTQCNDLSVAFRYMYDLGIDFMFSRLVREGYQSFEFNEDE
KEMEKRAKNIGKSILYPMVNSIKNISKGELITEDFEIYLDSEEDLNEFLDYLKKLHIAFV
VKENQKFENGMHKVKIGRIYNSTNDKIKSHLDGNLW

BLAST