GenomeNet

>mox:DAMO_1068 K16150 glycogen synthase [EC:2.4.1.11] | (GenBank) protein of unknown function (A)
MRIMMVTGSLGGPSKPCGGAELHVLSLMQALSKRRHGIALLTGRSPNVPIQPPGVEAIFS
TKTAFPILLTKLFQFDPVVYLSTLRIFRAWPPDIVHLHSFFNLSFAPIAAANRLRIPVLA
TLHTYWPVCLRQQLCYNEDGSCRQRYASEICAPCLARGLRDKMGVRLPVPFVNLVLRRAW
RARRHLLQGVARFIAPSSTLARSLRESGFPTDRIVVIPHGLPQNNFALRPREPRFGQPGP
HLLYVGRLVAGKGVQYLLEAIPQIRRAFPDLIITIAGDGPYRPALEQLCTSLGLMRITRF
IGFRPRSHLAKLYAETDVIVIPSLSEVFSYVVLEAAAAGTPIVATTVGGIPEIVANGAVL
VPPGDAAALAGGILAVLSDPTAAAARARLSQNRSLECFKFETMVDRAEAVYAELLNDGCF
PIAPYPAVLAQPH

BLAST