GenomeNet

>mox:DAMO_1068 protein of unknown function; K16150 glycogen(starch) synthase [EC:2.4.1.11] (A)
MRIMMVTGSLGGPSKPCGGAELHVLSLMQALSKRRHGIALLTGRSPNVPIQPPGVEAIFS
TKTAFPILLTKLFQFDPVVYLSTLRIFRAWPPDIVHLHSFFNLSFAPIAAANRLRIPVLA
TLHTYWPVCLRQQLCYNEDGSCRQRYASEICAPCLARGLRDKMGVRLPVPFVNLVLRRAW
RARRHLLQGVARFIAPSSTLARSLRESGFPTDRIVVIPHGLPQNNFALRPREPRFGQPGP
HLLYVGRLVAGKGVQYLLEAIPQIRRAFPDLIITIAGDGPYRPALEQLCTSLGLMRITRF
IGFRPRSHLAKLYAETDVIVIPSLSEVFSYVVLEAAAAGTPIVATTVGGIPEIVANGAVL
VPPGDAAALAGGILAVLSDPTAAAARARLSQNRSLECFKFETMVDRAEAVYAELLNDGCF
PIAPYPAVLAQPH

BLAST