GenomeNet

>mox:DAMO_2165 cbbL; ribulose bisphosphate carboxylase large chain (RuBisCO large subunit) (EC:4.1.1.39); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MAGAAGTSKDPKDRYKAGGVVPYKQMGYWRPEYEPKDTDVIAVFRITPQEGVDPDEAAAA
VAGESSTATWTVVWTDRLTDHDAYRGKAYRVDPVPGSPGQYFAYIAYDLDLFEDGSIVNV
SASIIGNVFGFKPLKALRLEDMRFPVAYLKTFQGPPTGIVVERERLDKFGRPLLGATIKP
KLGLSGKNYGRVVYEALKGGLDFTKDDENINSQAFMHWRDRFLFAMEGVNRASAATGEVK
GHYLNISAGTMEDMYERAEFAKELGSVIIMIDLVIGYTAIQSISKWARKNDMMLHLHRAG
HSTYTRQKTHGVNFRVICKWMRMAGVDHIHAGTVIGKLEGDPYMVKGFYDTLRETHTPMN
LQNGLFFDQDWASLRKVMPVASGGIHAGQMHQLLHYFGEDVVMQFGGGTIGHPTGIAAGA
TANRVALEAMVQARNEGRDYFNEGPEILANAARWCQPLRTALEVWKDITFNYASTDTADF
VPTTTAV

BLAST