GenomeNet

>mox:DAMO_2166 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) cbbS; Ribulose bisphosphate carboxylase small chain (RuBisCO small subunit) (A)
MRITQGTFSFLADLTDDQIRKQVEYALNNKWAVSVEFTDDPHPRNTFWEMWGLPMFDLED
PAGVMYEIDACRKAYPNHYIKVNAFDHNKGWETIRLSFIIHRPPHEPGFGLVRQEVKGRT
VNYVVHSYATDKPEGARYTD

BLAST