GenomeNet

>mox:DAMO_2166 cbbS; ribulose bisphosphate carboxylase small chain (RuBisCO small subunit) (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRITQGTFSFLADLTDDQIRKQVEYALNNKWAVSVEFTDDPHPRNTFWEMWGLPMFDLED
PAGVMYEIDACRKAYPNHYIKVNAFDHNKGWETIRLSFIIHRPPHEPGFGLVRQEVKGRT
VNYVVHSYATDKPEGARYTD

BLAST