GenomeNet

>mox:DAMO_2474 hypothetical protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MLKPATKNVRRFVVHEHRATHLHYDFRLEMGGVLRSWAVPRGPSMNPADKRLAMMVADHP
VDYIDFEGIIPEGRYGAGPVVVWDEGTYETIESTSPEVQLEEGKFAFILKGRKLKGAFTL
ARFARGETGQEWLLMKKRDQFTDPAWTLRSELTPTRLRALTVKIPPRETS

BLAST