GenomeNet

>mox:DAMO_2474 no KO assigned | (GenBank) conserved protein of unknown function (A)
MLKPATKNVRRFVVHEHRATHLHYDFRLEMGGVLRSWAVPRGPSMNPADKRLAMMVADHP
VDYIDFEGIIPEGRYGAGPVVVWDEGTYETIESTSPEVQLEEGKFAFILKGRKLKGAFTL
ARFARGETGQEWLLMKKRDQFTDPAWTLRSELTPTRLRALTVKIPPRETS

BLAST