GenomeNet

>mox:DAMO_2474 hypothetical protein (A)
MLKPATKNVRRFVVHEHRATHLHYDFRLEMGGVLRSWAVPRGPSMNPADKRLAMMVADHP
VDYIDFEGIIPEGRYGAGPVVVWDEGTYETIESTSPEVQLEEGKFAFILKGRKLKGAFTL
ARFARGETGQEWLLMKKRDQFTDPAWTLRSELTPTRLRALTVKIPPRETS

BLAST