GenomeNet

>mpa:MAP0880 ATP-dependent DNA ligase (EC:6.5.1.1); K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MNAPRAWPAEPTATPRVKLTNADKVLYPATGTTKADVFDYYTRIADVMIPHIAGRPVTRK
RWPNGVDQESFFEKQLASSAPDWLPRASVTHRSGTTTYPIIDSATGLAWIAQQAALEVHV
PQWRFVAEWTRSRAEELKPGPATRLVFDLDPGEGVTMAQLAEVARAVRDLIDGIGLQTFP
LTSGSKGLHLYTPLTEPVSSKGATVLAKRVAQQLEKTMPKLVTSTMTKSLRAGKIFVDWS
QNNGSKTTIAPYSLRGRDHPTVAAPRTWDELDDPALRHLRYDEVLTRVARDGDLLAELDD
NQTPVPDRLTKYRSMRDASKTPEPVPDAKPAAGQGNTFVIQEHHARRLHYDFRLERDGVL
VSWAVPKNLPDTPAVNHLAVHTEDHPLEYGGFEGVIPKGEYGAGRVVIWDSGTYDAEKFQ
DDEVIVNLHGRKISGRYALIQTQGDQWLAHRMKDQNVFEFDTIAPMLATHGSVSALKASQ
WAFEGKWDGYRLLVEADHGTLRVRSRRGREVTGEYRELRSLAKALEEHHAVLDGEAVVLD
KRGVPNFHEMQNRGKSARVEFWAFDLLYLDGRSLLRARYRDRRKLLEMLASGGALTVPEL
LPGDGDQALRQSAERGWEGVIAKRRDSTYQPGRRSSSWIKDKHWNTQEVVIGGWKAGEGG
RSSGIGSLLMGIPGPGGLHFAGRVGTGFTERDLANLKKTLAPLRTDQSPFDAPLPRSEAK
GVTFVEPVLVGEVRYSEWTPDDRLRQSSWRGLRPDKEASEVVRE

BLAST