GenomeNet

>mpa:MAP1329c hypothetical protein (A)
MAERDRHGTDLAGTRRGAGAGAVTDFAALPDSVRAALRDEPVPQWCSPTLATLTEKRFSD
PHWIFERKFDGMRCLAFRDGDRVRLLSRNRKPLNGTYPELVESLAAQRETRFVLDGEVVA
FEGRRTSFARLQGRLGITDPDVARASSVRIYYYVFDLLHLDGKSTVAVPLIWRKRLLRKA
IDFTDPLRYAPHRVGDGMAAYRAACGRGDEGVIAKRAESAYDGRRSENWLKFKCVRDQEF
VVGGYTSPKGKRLELGALLLGYYQGDQLRYAGKVGTGFDEATLHRLHQLLSGIACDTTPF
TRSLVPEAGAHWVRPELVVQIGFTEWTRDGKLRHPRYLGIRTDKDPTEVIRETR

BLAST