GenomeNet

>mpa:MAP1447c hypothetical protein; K16051 3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5] (A)
MDSGTTRGDAHVNTDVTPIPASSITSWDHEADVVIAGYGVAGAAAAVEAARAGADVLVLE
RTGSWGGAAAMAGGFIYLGGGTPIQKACGFTDSVDNMAAFLNVAMGPGADADRIADYCAG
SLAHFEWLVGCGVPFKAEFFGEPGWEPMGDQGLMYSGGENSYPFNTIASPAPRGHVPQMQ
NKKQGEASAGYMLMKPLVETATAAGARALYDVRVQRLITESDGRVVGMRARKYGTEMNIR
ARTGVVLATGSFAYNDSMVARYAPRIAGRPAASIEQHDGQAIRMAQALGADLAHMDATEV
AIFIDPQQLVRGILVNGRGQRYVAEDTYPGRIGQLTLYQQDNTAYLIIDGDAQDEAMASW
SPKLMLRPATWVADTVADLERDMALPPGSLQDTVAAYNAGATRGEDPLLHKKPEWIRPIG
SPVGAVDLRESTGGFTLGGLATTLDAEVLHVSGQPIPGLFAAGRCTAGLAAWGYASGISL
GDGSFYGRRAGASAAGRRLPRV

BLAST