GenomeNet

>mpa:MAP3064 hypothetical protein; K16150 glycogen(starch) synthase [EC:2.4.1.11] (A)
MKILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDSRTHPSTDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHAMIRAGLPPKLHDKKPGGNRPWRPDVVHAHDW
LVAHPAIALAQFYDVPMVSTIHATEAGRHSGWVSGPISRQVHAIESWLVRESDSLITCSA
SMADEITELFGPGLAEITVIRNGIETARWPFAPRRPRTGPAELLYLGRLEYEKGVHDVIA
ALPRIRRTHPGTTLTIAGEGTQQGWLVEQARKHRVLKAIRFVGHLEHSELLAMLHRADAA
VLPSHYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGQTGVSCPPRDVPALAAAIRTVL
DDPEAAQRRACAARERLTSDFDWHTVADKTAQVYLSAKRAERQPQARLPIVEHALPDR

BLAST