GenomeNet

>mpe:MYPE10320 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) MYPE10320; thymidine kinase (A)
MKNNAFGKEKGWIELIYGPMFAGKSEELLRKLKRLDYADVIYQVFKPKIDTRTKNKIMSR
DGRNMDSFEFDNPYEIFDKLLSLEVNPHVVAIDEAQFADESIVDVCQALADSGYIVYVSA
LDKNFKNEPFMVTAKIACIAEYVEKLSAICTDCGAPGTATQRIINDKPSNYDEPVVQIGN
YETYTVKCRHHHKIPGKPFPEEIKKFKSDLRNLLKNKENK

BLAST