GenomeNet

>mpg:Theba_0059 ATP-grasp enzyme, D-alanine-D-alanine ligase; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MRITVVHDTPLNLHHQEMVNSVVSSLEKIFEVDSRPFEIDAVGRLRGTDLVFNLTTAMGN
TERQVHLPAVLDLLGIPFTGSGTTANALCINKTLTKLIMKAYGISTPEFFSVRPGETADN
LPFSPAIVKPVKEGGAKGIWEDSVVESVDDMQRAVSRIHERFQQPALVERFIEGREFTVG
IVGNEVLPIMEIDFSSLPDHLETFYSYRVKQFHGDETNYICPAKISRREETVIREFSMRV
FQVLDLKDYCRIDLKIDDEGKIYFLEVNSLPLLVPDYSDIVKMAETRGWSYEDLINRIVA
SAIRRYGIGKENGRV

BLAST