GenomeNet

>mph:MLP_05970 no KO assigned | (GenBank) hypothetical protein (A)
MTERIELEVGDRVVKLSNPDRVYFSVRGETKLDLAEYYLAVADGIVNALYHRPCMLHRFP
DGVDGEKVHQKRLPRGAPDWVETVRVHFPRYSRFADELCVSHPADVIWAVQMSTVEFHPW
NSRRDDTEKPDEWRIDLDPGPLATYDDIRRVAAIVEEVLAELGAVGYPKTSGGKGLHIYV
RIPPVHGFADVRRAAWAFAREVERRAGGLVDLTWWRKDRDPATVFVDYNQNARDHTIASA
YSVRGTPEGLVSTPVRWAEIPDADPHDFTIATVPHRYAEIGDLHADIDDHPYSLDTLLEW
AERDERAGKAPAEPS

BLAST