GenomeNet

>mph:MLP_19640 ribulose bisphosphate carboxylase small chain family protein; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MTFRYGAFSYLPDLTDDEIAAQVKYALDHGWPVSIEYTDDPHPRNIYWEMWGLPLFDLAE
PDGVLDQINECRTAFPEHYVRMLAYDASLGKQTTAMSFLVQRPTSEPGFLLERQEGPDRT
QRYSVRSYATDGPAGTRYPVG

BLAST