GenomeNet

>mph:MLP_19640 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) ribulose bisphosphate carboxylase small chain family protein (A)
MTFRYGAFSYLPDLTDDEIAAQVKYALDHGWPVSIEYTDDPHPRNIYWEMWGLPLFDLAE
PDGVLDQINECRTAFPEHYVRMLAYDASLGKQTTAMSFLVQRPTSEPGFLLERQEGPDRT
QRYSVRSYATDGPAGTRYPVG

BLAST