GenomeNet

>mph:MLP_23260 hypothetical protein (A)
MAKSAAATVTAGEREVRVSSPDRIIYEATERTPAVTKLQVCEYFAAVGEPLMRALGERPT
AMERWPDGWREGMRLAIGTQDREADGFYQKRLPKGAPDFVETVKVTFPSGRTADELCPTE
PAALVWAAQMGALTFHPWPVRRPDVDHPDELRLDLDPQPGTTFADAQRIAGVARELLEEL
GMRGYPKTSGNRGIHIYVRIQPDHTFEDVRHAAIGFGRELERRDGGVTTNWWKEERGQRI
FIDFNQNNRDRTIASAWSLRARPGAPVSTPMTWERLAEITDPREFNLTTVPDYLADGDPW
ADMDEVAYPLEPLLQLWETLPGGELNFPPDYPKMPGEPPRVQPSKKVASHWDEDGNRIG

BLAST