GenomeNet

>mpl:Mpal_2014 K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] | (GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein (A)
MLKILEGSIAVAEAVKQCRPQVIAAYPITPQTHIVEALADIVANGELDCEYITVESEFSA
LSACLGASAAGSRTYSATTSQGLALMFEVCFNVAGLRLPIVMTIANRALGAPLSIWNDQQ
DSISLRDSGWLQFYAEDNQEATDLHYIAYRVAEHHDVLLPAFVCFDGFILSHTYEPVDML
SQEDADRFMKPFDPLYRLDAAAPVSMGMYATPEYYLEFRYEHDQAQHRAKKIIAEVGREF
GELFGRDYSALVEGYRLEDAEVALVAMGSLCGTTKDAIDEMRAAGKKVGLLKIRTFRPFP
TEEVAAALKHVQTVAVLDKNISLGAKGAVALEVKDALYNSGVRVFDYILGLGGRDVRKRD
IAAIVELAESGKGDLFYGLRTEVL

BLAST