GenomeNet

>mpp:MICPUCDRAFT_57578 hypothetical protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MPPAALSFADMLDGSPASLAKLRARFDAAAREEKRVFESPVKRSTIDPSAAAALGAAFAE
MMSASPANLVTMRERHDGESSTPTSSSVRHLSRQLLSPHPAPSTISLSPRDDATRAEPAP
AADFADMFAASPATLAKMRAASRARDDHPHGGDARASGKKHRASIDDASAADPGRFDDMF
AASPAQLAKLRAASARASPSGASSSSFPGFTTTSGNKGSHPYGDDRFVVVYDVVAADETE
CREKVLAICLEQTVELPASLVPEGTWIRENVVGRLEKLTPRAGLRGSYRCEISYHTDTAG
NEISQLINVVFGNTSMKEGVMVADLIAPPSVLAAYPGPKFGVRGLRKLLGVPRGPIIMTA
LKPMGSSTAALAEMAYKFAKGGIDVVKDDHGLADQPYSPYDERVVACAAAVRRANEETGR
RCIYAPCVNAPAHLVAKRAFAAKAAGAGAVLMIPGITGLDTMRELADDESFGLPIICHPA
MLGAMLGGGSYDRVGGFSHEVLLGALPRVAGADATIFPSFGGRFGFSVKECEGIARGARR
PMGGMPDIFPSPGGGMTMERVAAMNEVYGEDVLLLIGGSLMGHSPDLVANAKHFMKIAGR
TDLYGPKENGGKGGGAGDVGGGGKDGKKVDFEALVSR

BLAST