GenomeNet

>mpr:MPER_00887 hypothetical protein; K02358 elongation factor Tu (A)
TLGSRRGYATYNRTKPHMNIGTIGHVDHGKTTLTAAITKVLAEKGGATFTDYAQIDKAPE
EKARGITINSSHVEYETDTRHYGHIDCPGHADYIKNMITGAAQMDGAIIVVSATDGQMPQ
TREHLLLARQVGIKRLVVFINKVDMISDKEMLELVDMKMSDL

BLAST