GenomeNet

>mpr:MPER_04819 K11429 histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
MDPSRRLPKVQAKDLLDIVRRLVTTKGLVHVVIRQAVDELLSLMPIRYYLQNYTQKQINA
FATHASRYFELYQPFGSIEISHTSRYSHRTGKSELCILATKSLAPGTVITELKGSMANLT
DEEDRELKRTDLRTSDIRRDFSVIHSKSMKKNHLFLGPARFVNHDCDNNCELFREGRYIT
FRVIKPITIGEEITAHYGDGYFGKKNRQCLCETCEKGGRGG

BLAST